PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT31805
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 300aa    MW: 33458.7 Da    PI: 5.7276
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT31805genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1324.4e-41281441128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvg 101
               lppGfrFhPtd+elvv+yL++kv+g++ ++  +i+evd+yk++PwdLp+++  +++ewyfF++rd+ky++g+ +nr++ +gyWkatg dk+v +++++   
  EMT31805  28 LPPGFRFHPTDDELVVHYLCRKVAGQPQPV-PIIAEVDLYKFNPWDLPERALFGSREWYFFTPRDRKYPNGSPPNRSAGTGYWKATGADKPVERTRRA--- 124
               79*************************999.88***************8777899*************************************993332... PP

       NAM 102 lkktLvfykgrapkgektdWvmheyrl 128
                        grap+g+ktdW+mheyr+
  EMT31805 125 -------AAGRAPRGVKTDWIMHEYRI 144
               .......369***************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.12E-5424170IPR003441NAC domain
PROSITE profilePS5100543.39928170IPR003441NAC domain
PfamPF023655.8E-2129144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MVKAESTTAA AAAEGSSGRR DAEAELNLPP GFRFHPTDDE LVVHYLCRKV AGQPQPVPII  60
AEVDLYKFNP WDLPERALFG SREWYFFTPR DRKYPNGSPP NRSAGTGYWK ATGADKPVER  120
TRRAAAGRAP RGVKTDWIMH EYRIAEADRA PGKKGSLKLD EWVLCRLYNK KNNWEKLKVE  180
QDMAVEAGPN GEVMDALATD AMSDSFQTHD SSEIDSASGL QQHGFMDMAQ GQPRGGMVTV  240
KEDSDWFTGL SMDDLQTCYM NMGQMVNPAT MPGQNGSGYL QPMSSPQMMR PMWQTILPPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-85151762174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ9853290.0GQ985329.1 Triticum aestivum transcription factor TaNAC4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564478.11e-168PREDICTED: NAC domain-containing protein 68-like
SwissprotQ52QH41e-141NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLM8C3G80.0M8C3G8_AEGTA; Uncharacterized protein
STRINGMLOC_70929.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP53893761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.11e-71NAC domain containing protein 32